royal-peptides.com
OFFICIAL ROYAL PEPTIDES WEBSITE You are on royal-peptides.com
VERIFY OFFICIAL SITE

Royal Peptides

ROYAL RESEARCH CATALOG

LL-37 Kit

Research Material Batch Documentation Secure Checkout
Price range: $390 through $560
Choose an option
Clear selection
01Research focusedLaboratory research materials
02DocumentedAvailable batch information
03TrackedOrder fulfillment updates
Secure payment VISA link $
RESEARCH NOTICE
For laboratory and research purposes only.Not intended for human consumption, diagnostic use, therapeutic use, or administration to humans or animals.
View Documentation →
ankh
Human Cathelicidin Research Peptide • Research Use Only

LL-37 Peptide 5mg — Cathelicidin Research Dossier

LL-37 peptide is a naturally occurring 37-amino-acid human cathelicidin-derived peptide extensively investigated in innate immunity, antimicrobial activity, microbial membrane interactions, biofilm biology, inflammatory signaling and tissue-response research.

Research Compound LL-37
Research Format 5mg
Peptide Length 37 Amino Acids
Classification Cathelicidin

What Is LL-37 Peptide?

LL-37 is the principal human cathelicidin antimicrobial peptide. It is generated through proteolytic processing of the human cathelicidin precursor protein hCAP18, which is encoded by the CAMP gene.

The name LL-37 refers to two defining structural characteristics: the mature peptide begins with two leucine residues (LL) and consists of 37 amino-acid residues.

LL-37 has attracted substantial research interest because its biological activity extends beyond direct interactions with microorganisms. Experimental studies have examined its involvement in innate immune signaling, inflammatory responses, chemotaxis, membrane biology and tissue-response pathways.

LL-37 Amino-Acid Sequence and Structure

LL-37 is a cationic peptide containing 37 amino-acid residues. Its positive charge and amphipathic characteristics are important areas of research because they influence interactions between the peptide and biological membranes.

[LL-37, 37 aa]

In membrane-associated environments, LL-37 can adopt an alpha-helical conformation. Researchers have investigated how this structural behavior contributes to peptide-membrane interactions and other biological functions.

LL-37, hCAP18 and the CAMP Gene

LL-37 does not initially exist as an isolated 37-residue peptide inside human cells. It originates from the larger precursor protein human cationic antimicrobial protein 18 (hCAP18).

hCAP18 is encoded by the CAMP gene. Enzymatic processing releases the C-terminal LL-37 sequence from the precursor, producing the mature peptide studied extensively in innate-immunity research.

CAMP Gene Encodes the human cathelicidin antimicrobial peptide precursor.
hCAP18 Precursor protein from which mature LL-37 can be released.
LL-37 37-residue mature peptide investigated across innate immune and antimicrobial research.

LL-37 Antimicrobial Peptide Research

LL-37 is widely classified as an antimicrobial peptide (AMP). A major area of laboratory research involves its interaction with microbial membranes.

Because LL-37 is both cationic and amphipathic, investigators have examined how electrostatic and hydrophobic interactions influence its association with lipid membranes.

Experimental studies have evaluated LL-37 against numerous microorganisms under controlled laboratory conditions, including models involving Gram-positive bacteria, Gram-negative bacteria and fungal organisms.

Research Context Antimicrobial activity observed in laboratory experiments does not mean LL-37 is an approved antimicrobial drug or treatment for an infection.

LL-37 and Biofilm Research

LL-37 biofilm research is another important area of antimicrobial-peptide investigation.

Biofilms are structured microbial communities in which cells exist within a self-produced extracellular matrix. Their biology differs considerably from freely suspended microbial cells, making biofilms an important model for studying microbial organization, signaling and environmental persistence.

Researchers have examined LL-37 in experimental biofilm systems to investigate effects on processes such as surface attachment, microbial communication, biofilm development and membrane-associated activity.

These studies help researchers better understand the broader role antimicrobial peptides may play in host-microbe interactions.

LL-37 and Innate Immunity Research

LL-37 is an important research target in innate immunity, the collection of rapid biological defense mechanisms that respond to environmental and microbial signals.

Human cells associated with barrier tissues and immune responses can express cathelicidin-related molecules. This has led researchers to investigate LL-37 not simply as an antimicrobial peptide, but as a signaling molecule operating at the intersection of host defense, inflammation and cellular communication.

Host-Defense Research

LL-37 is studied as part of the endogenous peptide systems associated with early innate immune responses.

Immune-Cell Signaling

Experimental research has examined interactions between LL-37 and signaling pathways involved in immune-cell recruitment and cellular communication.

LL-37 and Immunomodulatory Signaling

One reason LL-37 remains an active research subject is that its biological behavior appears more complex than simple direct antimicrobial activity.

Experimental research has examined interactions involving chemotactic signaling, cytokine-associated pathways, immune-cell recruitment and receptor-mediated cellular communication.

These observations have contributed to LL-37 being studied as an immunomodulatory peptide as well as an antimicrobial peptide.

Innate Immunity Cathelicidin CAMP hCAP18 Chemotaxis Cell Signaling Host Defense

LL-37 and Inflammation Research

The relationship between LL-37 and inflammatory signaling is complex and context dependent.

Researchers have investigated LL-37 in models examining inflammatory mediators, immune-cell behavior, cellular stress and interactions between innate immune signaling pathways.

Depending on the experimental system, concentration, cellular environment and other variables, LL-37-associated responses may differ substantially. This makes the peptide particularly useful for mechanistic research into the regulation of inflammatory biology.

LL-37 and Tissue-Response Research

LL-37 has also been investigated in experimental models involving epithelial biology, keratinocytes, fibroblasts, endothelial cells and tissue-response signaling.

Laboratory studies have examined processes associated with cellular migration, barrier biology, angiogenic signaling and communication between immune and structural cells.

This area of research is often discussed in relation to wound-response biology. Such research describes experimental mechanisms and should not be interpreted as evidence that an LL-37 research product heals wounds or treats tissue injuries.

LL-37 Research Areas

Antimicrobial Research

Laboratory investigation of LL-37 interactions with microbial membranes and antimicrobial peptide mechanisms.

Biofilm Biology

Research involving microbial attachment, biofilm development and peptide interactions with structured microbial communities.

Innate Immune Signaling

Investigation of LL-37 within endogenous host-defense and immune-cell signaling systems.

Inflammatory Biology

Experimental analysis of context-dependent interactions between LL-37 and inflammatory signaling pathways.

Membrane Research

Investigation of how the cationic and amphipathic structure of LL-37 influences interactions with lipid membranes.

Cellular Response Research

Studies involving epithelial cells, fibroblasts, endothelial cells and other cellular models associated with tissue responses.

LL-37 5mg Research Specifications

Compound LL-37
Product Format 5mg
Classification Human Cathelicidin Peptide
Peptide Length 37 Amino Acids
Precursor hCAP18
Gene CAMP
Research Class Antimicrobial Peptide
Form Lyophilized Research Material

Why Is LL-37 Studied?

LL-37 is scientifically interesting because a single endogenous peptide participates in several interconnected areas of biological research.

Its cationic amphipathic structure makes it valuable for membrane and antimicrobial peptide research, while its endogenous role as a human cathelicidin makes it relevant to innate immune and host-defense biology.

At the same time, research involving inflammatory signaling, chemotaxis, cellular migration and tissue responses demonstrates why LL-37 is often studied as a multifunctional signaling peptide rather than exclusively as an antimicrobial molecule.

LL-37 Peptide FAQ

What is LL-37 peptide?

LL-37 is a 37-amino-acid human cathelicidin-derived peptide studied extensively in antimicrobial, innate immunity, inflammatory signaling, biofilm and cellular-response research.

What does LL-37 stand for?

The name refers to the two leucine residues at the beginning of the mature peptide sequence, represented by LL, and its total length of 37 amino-acid residues.

Is LL-37 an antimicrobial peptide?

Yes. LL-37 is widely classified as a human antimicrobial peptide and has been extensively investigated in laboratory models involving microbial membranes and host-defense biology.

What is the LL-37 amino-acid sequence?

The 37-amino-acid LL-37 sequence is [LL-37, 37 aa]

What is hCAP18?

hCAP18 is the human cathelicidin precursor protein from which the mature LL-37 peptide is released through proteolytic processing.

What is the CAMP gene?

CAMP is the gene that encodes the human cathelicidin antimicrobial peptide precursor associated with hCAP18 and LL-37.

Why is LL-37 studied in biofilm research?

Researchers have investigated LL-37 in experimental biofilm systems to study microbial attachment, biofilm development, membrane interactions and other aspects of host-microbe biology.

Is LL-37 approved for human use?

LL-37 research material is not an approved medication. Royal Peptides supplies LL-37 5mg strictly for laboratory, analytical and research purposes.

For Research Use Only LL-37 5mg is supplied strictly for laboratory, analytical and research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or mitigation of disease. References to antimicrobial activity, immunity, inflammation, biofilms or tissue-response pathways describe areas of scientific investigation and do not represent therapeutic claims.
0